org.biojava.bio.program.sax
public class ClustalWAlignmentSAXParser extends Object
K1C0_XENLA/125-441 DKVHALETANTELERKIKEWYEKQRPGSSSGDGAKDYSKYYT K1C4_XENLA/81-396 EKVRALEAANADLELKIREWYEKQK-GSGIGAGSKDFSKYFE K1C5_XENLA/73-384 DRVRSLEQANHELELKIREYLDKK-----AAVGSLDYSGYYN keratin15 DKVRALEEANADLEVKIHDWYQKQTP----ASPECDYSQYFK K1C0_XENLA/125-441 -----AKFLLQNDNARLAADDFKMKFEN-------------- K1C4_XENLA/81-396 -----SRVVLQIDNAKLAADDFRLKFEN-------------- K1C5_XENLA/73-384 -----TRLVLSIDNAKLAADDFKIKYES-------------- keratin15 -----SRVILEIDNARLAADDFRLKYEN--------------
Please note, this parser reads the whole alignment in to core memory and thus does not scale to work with very large alignments on low-end hardware.
Please also note that this class has not been tested with many version of CLUSTAL W. Copyright © 2000,2001 Cambridge Antibody Technology.
Primary author -
| Modifier and Type | Field and Description |
|---|---|
protected int |
iState |
protected String |
oFullNamespacePrefix |
protected ContentHandler |
oHandler |
protected String |
oNamespacePrefix |
protected boolean |
tNamespacePrefixes |
protected boolean |
tNamespaces |
| Constructor and Description |
|---|
ClustalWAlignmentSAXParser()
Initialises internal state
Sets namespace prefix to "biojava"
|
| Modifier and Type | Method and Description |
|---|---|
void |
addPrefixMapping(String poPrefix,
String poURI)
Adds a namespace prefix to URI mapping as (key,value) pairs.
|
protected void |
changeState(int piState)
Centralise chaining of iState field to help
with debugging.
|
protected void |
characters(char[] ch,
int start,
int length)
Utility method to centralize the sending of a SAX characters
message a document handler.
|
protected void |
endElement(org.biojava.bio.program.sax.QName poQName)
Utility method to centralize the sending of a SAX endElement
message a document handler.
|
ContentHandler |
getContentHandler()
Return the content handler.
|
protected BufferedReader |
getContentStream(InputSource poSource)
Create a stream from an an InputSource, picking the
correct stream according to order of precedance.
|
DTDHandler |
getDTDHandler()
Do-nothing implementation of interface method
|
EntityResolver |
getEntityResolver()
Do-nothing implementation of interface method
|
ErrorHandler |
getErrorHandler()
Do-nothing implementation of interface method
|
boolean |
getFeature(String poName)
Do-nothing implementation of interface method
|
String |
getNamespacePrefix()
Describe
getNamespacePrefix method here. |
boolean |
getNamespacePrefixes()
Support SAX2 configuration of namespace support of parser.
|
boolean |
getNamespaces()
Support SAX2 configuration of namespace support of parser.
|
Object |
getProperty(String name)
Do-nothing implementation of interface method
|
String |
getURIFromPrefix(String poPrefix)
Gets the URI for a namespace prefix, given that prefix,
or null if the prefix is not recognised.
|
void |
parse(InputSource poSource)
Describe 'parse' method here.
|
void |
parse(String poSystemId)
Full implementation of interface method.
|
String |
prefix(String poElementName)
Given an unprefixed element name, returns
a new element name with a namespace prefix
|
void |
setContentHandler(ContentHandler poHandler)
Allow an application to register a content event handler.
|
void |
setDTDHandler(DTDHandler handler)
Do-nothing implementation of interface method
|
void |
setEntityResolver(EntityResolver resolver)
Do-nothing implementation of interface method
|
void |
setErrorHandler(ErrorHandler handler)
Do-nothing implementation of interface method
|
void |
setFeature(String poName,
boolean value)
Handles support for ReasoningDomain and Namespace-prefixes
|
void |
setNamespacePrefix(String poPrefix) |
void |
setProperty(String name,
Object value)
Do-nothing implementation of interface method
|
protected void |
startElement(org.biojava.bio.program.sax.QName poQName,
Attributes atts)
Utility method to centralize sending of a SAX
startElement message to document handler
|
protected ContentHandler oHandler
protected boolean tNamespaces
protected boolean tNamespacePrefixes
protected String oNamespacePrefix
protected String oFullNamespacePrefix
protected int iState
public ClustalWAlignmentSAXParser()
public void parse(InputSource poSource) throws IOException, SAXException
parse in interface XMLReaderpoSource - -IOExceptionSAXExceptionpublic void setContentHandler(ContentHandler poHandler)
Applications may register a new or different handler in the middle of a parse, and the SAX parser must begin using the new handler immediately.
setContentHandler in interface XMLReaderpoHandler - a ContentHandler The XML content handlerNullPointerException - If the handler argument is nullpublic ContentHandler getContentHandler()
getContentHandler in interface XMLReaderContentHandler The current content handler,
or null if none has been registered.public void parse(String poSystemId) throws IOException, SAXException
parse in interface XMLReaderIOExceptionSAXExceptionpublic boolean getFeature(String poName) throws SAXNotRecognizedException, SAXNotSupportedException
getFeature in interface XMLReaderSAXNotRecognizedExceptionSAXNotSupportedExceptionpublic void setFeature(String poName, boolean value) throws SAXNotRecognizedException, SAXNotSupportedException
setFeature in interface XMLReaderSAXNotRecognizedExceptionSAXNotSupportedExceptionpublic Object getProperty(String name) throws SAXNotRecognizedException, SAXNotSupportedException
getProperty in interface XMLReaderSAXNotRecognizedExceptionSAXNotSupportedExceptionpublic void setProperty(String name, Object value) throws SAXNotRecognizedException, SAXNotSupportedException
setProperty in interface XMLReaderSAXNotRecognizedExceptionSAXNotSupportedExceptionpublic void setEntityResolver(EntityResolver resolver)
setEntityResolver in interface XMLReaderpublic EntityResolver getEntityResolver()
getEntityResolver in interface XMLReaderpublic void setDTDHandler(DTDHandler handler)
setDTDHandler in interface XMLReaderpublic DTDHandler getDTDHandler()
getDTDHandler in interface XMLReaderpublic void setErrorHandler(ErrorHandler handler)
setErrorHandler in interface XMLReaderpublic ErrorHandler getErrorHandler()
getErrorHandler in interface XMLReaderprotected void startElement(org.biojava.bio.program.sax.QName poQName,
Attributes atts)
throws SAXException
poQName - a QName valueatts - an Attributes valueSAXException - if an error occursprotected void endElement(org.biojava.bio.program.sax.QName poQName)
throws SAXException
poQName - -SAXException - thrown ifthrown - ifprotected void characters(char[] ch,
int start,
int length)
throws SAXException
ch - -start - -length - -SAXException - thrown ifthrown - ifpublic boolean getNamespaces()
public boolean getNamespacePrefixes()
public void addPrefixMapping(String poPrefix, String poURI)
poPrefix - a String representation of the
namespace prefixpoURI - a String representation of the URI
for the namespace prefix.public String getURIFromPrefix(String poPrefix)
poPrefix - a String The namespace prefix.public void setNamespacePrefix(String poPrefix)
poPrefix - a String valuepublic String getNamespacePrefix()
getNamespacePrefix method here.String valuepublic String prefix(String poElementName)
String valueprotected BufferedReader getContentStream(InputSource poSource)
poSource - an InputSource valueBufferedReader valueprotected void changeState(int piState)
piState - an int value